PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g10640
Common NameGSCOC_T00029507001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family NAC
Protein Properties Length: 407aa    MW: 45141.7 Da    PI: 5.1461
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g10640genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.49.8e-52371641128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtdeelv +yL++k+ gk++++ +++ e+d+yk+ePw+L   +++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatgkd++v + k
  Cc02_g10640  37 LAPGFRFHPTDEELVRYYLRRKACGKPFRF-QAVCEIDVYKSEPWELAcySSLKTRDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRPVRH-K 132
                  579*************************99.88**************85336777888**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g+kktLvf++grap+g++t+Wvmheyrl
  Cc02_g10640 133 SQTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 164
                  99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6135187IPR003441NAC domain
PROSITE profilePS5100557.42437187IPR003441NAC domain
PfamPF023652.7E-2839164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MGQELVAVAV TPSSSTTAVV GGGIGGSPVG APPPTSLAPG FRFHPTDEEL VRYYLRRKAC  60
GKPFRFQAVC EIDVYKSEPW ELACYSSLKT RDLEWYFFSP VDRKYGNGSR LNRATGKGYW  120
KATGKDRPVR HKSQTIGMKK TLVFHSGRAP DGKRTNWVMH EYRLVDEELE KAGVAQDAFV  180
LCRIFQKSGL GPPNGDRYAP FVEEEWDDDT ALLIPGGEAE DDMANGDEAR VDCNDLTPDI  240
NKTPRLIEHP SEPQGIPFIC KRERSEDPEP LSLGQNKRSK QDGPNSSHAN GSEDSTTTSQ  300
DPPPTMMTTN FSSALLEFPL LESVEPKETQ PASTATFDSS NLEKSVPPGY LKFISNLENE  360
ILNVSMERET LKIEVMRAQA MINILQSRID LLNKENEDLR RLVRGG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-523618719168NAC domain-containing protein 19
3swm_B4e-523618719168NAC domain-containing protein 19
3swm_C4e-523618719168NAC domain-containing protein 19
3swm_D4e-523618719168NAC domain-containing protein 19
3swp_A4e-523618719168NAC domain-containing protein 19
3swp_B4e-523618719168NAC domain-containing protein 19
3swp_C4e-523618719168NAC domain-containing protein 19
3swp_D4e-523618719168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619467.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLA0A068TWS90.0A0A068TWS9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-112NAC domain containing protein 50